LL-37: Antimicrobial Peptide Research, Immune Defense & Wound Healing


Summary of Key Research References

Study Year Type Focus Reference
Kahlenberg & Kaplan 2013 Review LL-37 role in inflammation and autoimmune disease PMC3836506
Vandamme et al. 2012 Review LL-37 as treatment for polymicrobial infected wounds PMC3699762
Gordon et al. 2005 In Vitro LL-37 antibacterial and antiviral activity in ocular epithelia PMC1497871
Wu et al. 2010 Review LL-37 roles in human cancer and therapeutic applications PMC2930073
Chen et al. 2021 Review LL-37 as antimicrobial and anti-biofilm agent PMC8227053
Wan et al. 2020 In Vivo LL-37 therapeutic potential in murine sepsis model PMID 32825174
Barlow et al. 2010 In Vitro LL-37 modulation of neutrophil inflammatory response PMC2908514
Piktel et al. 2015 Review LL-37 and mimics as potential anticancer drugs PMC4485164

Written by NorthPeptide Research Team

Ready to explore research-grade peptides?

Browse All Peptides →

For laboratory and research use only. Not for human consumption.

Quick summary: LL-37 is the only cathelicidin antimicrobial peptide produced by the human body. It is a 37-amino-acid peptide (beginning with two leucine residues, hence “LL”) derived from the precursor protein hCAP18 (human cationic antimicrobial protein of 18 kDa), which is cleaved by proteinase 3 to release …

What Is LL-37?

LL-37 is the only cathelicidin antimicrobial peptide produced by the human body. It is a 37-amino-acid peptide (beginning with two leucine residues, hence “LL”) derived from the precursor protein hCAP18 (human cationic antimicrobial protein of 18 kDa), which is cleaved by proteinase 3 to release the active LL-37 peptide. The full sequence is [LL-37, 37 aa]

LL-37 is produced by neutrophils, macrophages, epithelial cells, and keratinocytes as a first-line defense against microbial invasion. It is found in wound fluid, sweat, saliva, breast milk, and on mucosal surfaces throughout the body. Its expression is upregulated by infection, inflammation, and vitamin D signaling — the latter connection explaining the well-documented relationship between vitamin D status and innate immune defense.

What distinguishes LL-37 from many antimicrobial agents is its dual functionality: it acts both as a direct antimicrobial that kills bacteria, viruses, and fungi through membrane disruption, and as an immunomodulatory signaling molecule that orchestrates the broader immune response. This dual role has made LL-37 one of the most extensively studied host defense peptides in the antimicrobial peptide (AMP) field, with over 3,000 publications in PubMed.

How LL-37 Works: Mechanism of Action

Direct Antimicrobial Activity

  • Membrane disruption — LL-37 adopts an alpha-helical conformation in the presence of lipid membranes. Its amphipathic structure (positively charged face + hydrophobic face) allows it to interact with negatively charged microbial membranes, inserting into and disrupting the lipid bilayer. This leads to membrane permeabilization, ion leakage, and rapid microbial death. Importantly, mammalian cell membranes are relatively resistant due to their different lipid composition (higher cholesterol content).
  • Broad-spectrum activity — LL-37 has demonstrated activity against Gram-positive bacteria (Staphylococcus aureus, including MRSA; Streptococcus species), Gram-negative bacteria (Escherichia coli, Pseudomonas aeruginosa, Klebsiella pneumoniae), fungi (Candida albicans), and enveloped viruses (including influenza, respiratory syncytial virus, and HIV).
  • Biofilm disruption — One of LL-37’s most clinically relevant properties is its ability to disrupt bacterial biofilms — structured microbial communities that are notoriously resistant to conventional antibiotics. LL-37 has been shown to prevent biofilm formation, disrupt established biofilms, and kill bacteria within biofilm matrices. This anti-biofilm activity has been documented against P. aeruginosa, S. aureus, and S. epidermidis biofilms and is considered critical in the context of chronic wound infections and device-related infections.
  • Synergy with conventional antibiotics — Research has documented synergistic interactions between LL-37 and several classes of conventional antibiotics, including beta-lactams and fluoroquinolones. The mechanism is thought to involve LL-37’s membrane-disrupting activity enhancing antibiotic penetration into bacterial cells.

Immunomodulatory Functions

  • Chemotaxis — LL-37 acts as a chemoattractant for neutrophils, monocytes, T cells, and mast cells through interaction with the formyl peptide receptor-like 1 (FPRL1/FPR2). This recruitment of immune cells to infection sites amplifies the local immune response.
  • Dendritic cell activation — LL-37 promotes dendritic cell maturation and antigen presentation, bridging innate and adaptive immunity. It enhances the capacity of DCs to prime T-cell responses against microbial antigens.
  • Anti-endotoxin activity — LL-37 binds to and neutralizes lipopolysaccharide (LPS/endotoxin), the major virulence factor of Gram-negative bacteria. By neutralizing LPS, LL-37 prevents the excessive inflammatory response (septic cascade) that can result from LPS-driven TLR4 activation. This anti-endotoxin activity is considered important in preventing sepsis progression.
  • Cytokine modulation — LL-37 influences the cytokine balance in a context-dependent manner — it can enhance pro-inflammatory responses during active infection (supporting pathogen clearance) while also limiting excessive inflammation through LPS neutralization and modulation of NF-κB signaling.
  • Angiogenesis promotion — LL-37 has been shown to stimulate endothelial cell proliferation and new blood vessel formation through FPRL1 and VEGF pathway activation, contributing to wound healing and tissue repair.
  • Wound healing enhancement — Beyond angiogenesis, LL-37 promotes wound healing through enhanced keratinocyte migration, fibroblast proliferation, and re-epithelialization. These effects position LL-37 as a multi-functional wound healing factor that addresses both the infectious and reparative aspects of wound management.

Antimicrobial Research in Detail

MRSA and Drug-Resistant Bacteria

The rise of antibiotic-resistant bacteria has created urgent need for alternative antimicrobial strategies. LL-37’s membrane-targeting mechanism is less susceptible to the resistance mechanisms that defeat conventional antibiotics (enzyme inactivation, efflux pumps, target modification), because the bacterial membrane itself is the target. Research has demonstrated LL-37 activity against multiple drug-resistant pathogens, including MRSA, vancomycin-resistant Enterococci (VRE), and multidrug-resistant Pseudomonas.

Chronic Wound Infections

Chronic wounds (diabetic ulcers, pressure injuries, venous ulcers) are frequently colonized by biofilm-forming bacteria that resist both immune clearance and topical antibiotics. LL-37’s combination of biofilm disruption, direct antimicrobial killing, and wound healing promotion makes it particularly relevant to chronic wound research. Studies have documented that chronic wounds often have reduced LL-37 levels compared to acute wounds, suggesting a deficiency state that may contribute to impaired wound defense and healing.

Respiratory Infections

LL-37 is produced by airway epithelial cells and is present in airway surface liquid. Research has investigated its role in respiratory defense against bacterial pneumonia, tuberculosis, and viral respiratory infections. In cystic fibrosis — a condition characterized by chronic pulmonary infection and reduced airway antimicrobial defense — LL-37 function is impaired by the high salt concentration in airway secretions, contributing to the infection susceptibility seen in this disease.

Wound Healing Research

LL-37’s wound healing properties extend beyond its antimicrobial effects and include direct tissue repair mechanisms:

  • Keratinocyte migration — LL-37 promotes the migration of keratinocytes across wound surfaces, a critical step in re-epithelialization
  • Fibroblast activation — Stimulation of fibroblast proliferation and collagen synthesis in the wound bed
  • Angiogenesis — New blood vessel formation to support tissue repair with oxygen and nutrient delivery
  • Anti-biofilm + healing combination — The simultaneous elimination of biofilm infection and promotion of tissue repair is a unique combination not offered by either antibiotics or growth factors alone

These wound healing mechanisms complement those of other research peptides including BPC-157 (VEGFR2/JAK-STAT pathways), TB-500 (actin regulation/cell migration), and GHK-Cu (collagen synthesis/gene regulation), each operating through distinct mechanisms.

Vitamin D Connection

The vitamin D-LL-37 axis is one of the most important connections in innate immunology. Vitamin D (specifically the active form 1,25-dihydroxyvitamin D3) directly induces LL-37 gene expression through the vitamin D response element (VDRE) in the cathelicidin gene promoter. This mechanism explains several observations:

  • Vitamin D deficiency is associated with increased susceptibility to infections
  • Vitamin D supplementation increases circulating LL-37 levels
  • Winter seasonality of infections correlates with both reduced vitamin D synthesis and lower LL-37 levels
  • The tuberculosis susceptibility associated with vitamin D deficiency may be partly mediated through reduced LL-37 production

Clinical and Translational Research

LL-37-Based Therapeutics in Development

Several LL-37-derived compounds are in clinical development:

  • OP-145 — An LL-37-derived peptide evaluated in phase I/II clinical trials for chronic otitis media (middle ear infection), demonstrating biofilm eradication and clinical improvement
  • Topical LL-37 formulations — Being evaluated for chronic wound infections and burn wound management
  • LL-37 gene therapy — Experimental approaches using viral vectors to deliver the cathelicidin gene to LL-37-deficient tissues

LL-37 Deficiency States

Research has identified several conditions associated with reduced LL-37 expression or function:

  • Vitamin D deficiency — the most common cause of reduced LL-37 expression
  • Morbus Kostmann (severe congenital neutropenia) — patients have absent LL-37 and suffer from severe periodontal disease
  • Chronic wounds — local LL-37 depletion contributes to infection persistence
  • Cystic fibrosis — impaired LL-37 function in high-salt airway environment
  • Aging — reduced LL-37 production contributes to immunosenescence

Comparison with Other Immune Peptides

Parameter LL-37 KPV Thymosin Alpha-1
Primary function Antimicrobial + immune modulation Anti-inflammatory (NF-κB) Adaptive immunity enhancement
Immune arm Innate (primarily) Innate (anti-inflammatory) Adaptive (T-cell, DC)
Antimicrobial Strong, broad-spectrum Moderate Indirect (via immune activation)
Anti-biofilm Yes (strong) No No
Wound healing Yes (multi-mechanism) Indirect (via inflammation control) No direct effect
Clinical data Phase I/II (derived compounds) Preclinical only Approved in 35+ countries

Dosing in Research Models

Research Context Concentration Format Notes
MIC determination (bacteria) 1–64 μg/mL Broth microdilution Species-dependent
Biofilm disruption 8–128 μg/mL Biofilm assay Higher than planktonic MIC
Cell migration assays 1–20 μg/mL Culture medium Wound scratch assay
Immune modulation 1–50 μg/mL Culture medium Cytokine/chemokine assays
Animal wound models 50–200 μg per wound Topical gel/solution Daily application

Reconstitution and Handling

  • Storage — Lyophilized LL-37 at -20°C, protected from light and moisture
  • Reconstitution — Reconstitute with sterile bacteriostatic water or appropriate buffer (PBS, pH 7.4). LL-37 is soluble in aqueous solution at concentrations up to 1–2 mg/mL.
  • Stability — Reconstituted LL-37 stable approximately 14–21 days at 2–8°C. The peptide is susceptible to proteolytic degradation in biological fluids, which limits its systemic half-life but is less relevant for topical or in vitro applications.
  • Salt sensitivity — LL-37’s antimicrobial activity is reduced at high salt concentrations (>100 mM NaCl), which is important to consider when designing assays.
  • Aggregation — At higher concentrations, LL-37 can form oligomeric structures. While this is a natural aspect of its biology (oligomerization may contribute to membrane disruption), it can affect solution consistency.

Safety Considerations

  • Selectivity — LL-37 preferentially targets microbial membranes over mammalian cells due to differences in membrane composition. However, at high concentrations, cytotoxicity to mammalian cells can occur — the therapeutic window depends on the application and delivery method.
  • Inflammatory balance — While LL-37 is generally protective, excessive or dysregulated LL-37 expression has been associated with certain inflammatory conditions. Psoriasis, for example, involves LL-37-mediated activation of plasmacytoid dendritic cells, contributing to the disease’s characteristic inflammation.
  • Natural human peptide — As an endogenous human defense molecule, LL-37 at physiological concentrations is inherently biocompatible.

Current Limitations and Future Directions

  • Systemic delivery challenges — LL-37’s susceptibility to proteolytic degradation limits its systemic half-life, making topical and local delivery the most practical routes
  • Manufacturing cost — Synthesizing a 37-amino-acid peptide at clinical scale is more expensive than small molecule antibiotics
  • Salt sensitivity — Reduced activity in high-salt environments limits some applications
  • Resistance potential — While less susceptible than conventional antibiotics, some bacteria have developed LL-37 resistance mechanisms (protease secretion, membrane modifications), raising long-term resistance concerns

Future research includes development of shorter, more stable LL-37 analogs, nanoparticle delivery systems for sustained release, combination strategies with conventional antibiotics for drug-resistant infections, and clinical trials in chronic wound management.

Summary

LL-37 is the sole human cathelicidin antimicrobial peptide, functioning as both a direct broad-spectrum antimicrobial and an immunomodulatory signaling molecule. Its combination of antimicrobial killing, biofilm disruption, immune cell recruitment, endotoxin neutralization, and wound healing promotion makes it a uniquely multi-functional host defense molecule. With over 3,000 publications and clinical-stage derivatives in development, LL-37 is one of the most extensively characterized antimicrobial peptides in the research literature, with particular relevance to chronic wound infections, antibiotic resistance, and innate immune defense research.

View LL-37 in our research catalog. Related immune defense peptides: Thymosin Alpha-1, KPV, and Thymulin.

This article is for informational and research purposes only. It does not constitute medical advice. All peptides sold by NorthPeptide are intended exclusively for laboratory and research use. Not for human consumption.

Similar Posts

Leave a Reply

Your email address will not be published. Required fields are marked *